PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00141.1.g00650.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 450aa    MW: 48855.5 Da    PI: 10.0072
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00141.1.g00650.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.92.1e-24203247145
                             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                     d+ep+rCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  Zjn_sc00141.1.g00650.1.sm.mkhc 203 DPEPWRCRRTDGKKWRCSKEAHPDSKYCERHMHRGRNRSRKPVES 247
                                     79****************************************986 PP

2QLQ62.51.2e-21133167236
                             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                                      FTaaQ+++L++Q+l+yKyL+a++PvPp+Ll++i+
  Zjn_sc00141.1.g00650.1.sm.mkhc 133 VFTAAQWAELEQQALIYKYLMAGVPVPPDLLLPIR 167
                                     5********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.4E-12132168IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.468133168IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.2E-16134167IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.346203247IPR014977WRC domain
PfamPF088795.6E-21204246IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MPLGRVASGY TRKRQTSKEG RAELRIAVGR ASASKSKPKR YLQIPHAHHA PPSPPFLPLL  60
LASINGRHQE PSNPHLTSST SAGSAPVLYR LLAWEGREGG QVDAETVAAS MLSSAAMGMG  120
GFPHQQQPRG AAVFTAAQWA ELEQQALIYK YLMAGVPVPP DLLLPIRPHS AAAFSFGPAI  180
GAASSFYHHP SLSYYAYYGK KLDPEPWRCR RTDGKKWRCS KEAHPDSKYC ERHMHRGRNR  240
SRKPVESKSA SPAHQSQPQL STVTNATRDT EPLQSLAMGA KTHGLSLGGA GSSQLQVDAS  300
SYGSKFSLGG KADVGELSFL SGASGNSRGF TIDSSSDSSW HSLSSNVPPF TLSTTRDSGL  360
LSGAYNYSNL EPSQELGQVT IATLSQDQER HSFNSGTGGL MKQENQSLRP FFDEWPATRD  420
SWSEDRRKPA REPELSRAAH KDGLEVRSSF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641602.11e-170PREDICTED: growth-regulating factor 5 isoform X1
RefseqXP_015641603.11e-170PREDICTED: growth-regulating factor 5 isoform X2
RefseqXP_015641605.11e-170PREDICTED: growth-regulating factor 5 isoform X4
SwissprotQ6AWY41e-172GRF5_ORYSJ; Growth-regulating factor 5
TrEMBLA0A0A9F0Q10.0A0A0A9F0Q1_ARUDO; Uncharacterized protein
STRINGBGIOSGA022056-PA1e-169(Oryza sativa Indica Group)
STRINGSi008818m1e-169(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110462431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-30growth-regulating factor 5